PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PK18183.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Cannabaceae; Cannabis
Family CO-like
Protein Properties Length: 507aa    MW: 56248.7 Da    PI: 6.2109
Description CO-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PK18183.1genomeCCBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-B_box27.75.8e-092770340
   zf-B_box  3 erkCpeHeekelqlfCedCqqllCedClleeHkg......Htvv 40
               +r C+ + +k+++++C  ++ +lC++C  + H+       H++v
  PK18183.1 27 ARACDSCVKKRARWYCAADDAFLCQSCDHSVHSAnslakrHERV 70
               578*****************************657788888876 PP

2CCT682.4e-23439482144
        CCT   1 ReaallRYkeKrktRkFeKkirYesRKavAesRpRvKGrFvkqa 44 
                Rea+++RY+eKr+tR+F+KkirYe+RK +Ae+RpR+KGrFvk++
  PK18183.1 439 REARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKRS 482
                9*****************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5011910.9932572IPR000315B-box-type zinc finger
SMARTSM003363.4E-92572IPR000315B-box-type zinc finger
PfamPF006432.9E-72770IPR000315B-box-type zinc finger
CDDcd000212.55E-102872No hitNo description
PfamPF062037.1E-18439481IPR010402CCT domain
PROSITE profilePS5101716.083439481IPR010402CCT domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005622Cellular Componentintracellular
GO:0016020Cellular Componentmembrane
GO:0005515Molecular Functionprotein binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 507 aa     Download sequence    Send to blast
MSNNTTTTTT SIYNKKASND VVGGKTARAC DSCVKKRARW YCAADDAFLC QSCDHSVHSA  60
NSLAKRHERV RLKTASSPIK LTELPSSPTW HRGFTKKART PRQAKQNNNN NKPHGSSSGS  120
SGTVPNPFSL VPEYLNSPEE ENEDQLLYRV PVYDPFVVAS QNAQVSKSTT SFGAANNNNN  180
LINGFVFPAQ EMDDLAEFAA DVESLLGHGL ENDECFGMKE LGFVDSKDET TTTTEESGGV  240
KVEKEEDQND DQLLAVGLGG NTSLDDMVMI TREPFQFNFD DYDDDVSPAP SCGVEEENDE  300
NNIMIKEMKN DNGNDVNDVV FDNKKNSSST SSMMMLIKKN KKMKKQKHQI LLRLDYEAVS  360
TAWATQGGSP WTTGDRPDLD PDSCLPDCMM LMSSSCETTQ MINDESNNNY LGSGSYVVGV  420
GRLSNTAALG LGLGLEEGRE ARVSRYREKR RTRLFSKKIR YEVRKLNAEK RPRMKGRFVK  480
RSSLTFVNNP PLPITTTTTT SFPNKLK
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1449465RRTRLFSKKIRYEVRKL
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010103762.11e-128Zinc finger protein CONSTANS-LIKE 16
TrEMBLW9SB571e-128W9SB57_9R
STRINGVIT_01s0011g03520.t011e-119(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF14733392
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G25440.19e-49B-box type zinc finger protein with CCT domain